Hsc70 (HSPA8) Rabbit Polyclonal Antibody TA346659 from OriGene Technologies | Biocompare.com

Supplier Images

Hsc70 (HSPA8) Rabbit Polyclonal Antibody

Be the first to write a review!

Supplier Page from
OriGene Technologies for
Hsc70 (HSPA8) Rabbit Polyclonal Antibody

The Hsc70 (HSPA8) Rabbit Polyclonal Antibody from OriGene Technologies is a Rabbit Polyclonal antibody to HSPA8. This antibody recognizes Human, Mouse, and Rat antigen. The Hsc70 (HSPA8) Rabbit Polyclonal Antibody has been validated for the following applications: Immunohistochemistry, and Western Blot.

Description

Rabbit Polyclonal Anti-HSPA8 Antibody

Product Specs
ItemHsc70 (HSPA8) Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price Pricing Info Supplier Page View Company Product Page
Catalog NumberTA346659
Quantity100 µl
ApplicationsIHC, WB
Conjugate/TagUnconjugated
PurityAffinity Purified
ReactivityRat, Human, Mouse
TargetHSPA8
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-HSPA8 antibody: synthetic peptide directed towards the N terminal of human HSPA8. Synthetic peptide located within the following region: MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERL
NCBI Full Gene Nameheat shock protein family A (Hsp70) member 8
NCBI Gene AliasesHEL-33, NIP71, HSPA10, LAP-1, HSC70, HSC71, HSC54, LAP1, HEL-S-72p, HSP71, HSP73
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!